Lineage for d1rrlb2 (1rrl B:8-167)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2045908Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology
    duplication: has weak internal pseudo twofold symmetry
  4. 2045909Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) (S)
  5. 2045910Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)
  6. 2045914Protein Plant lipoxigenase [49725] (2 species)
  7. 2045944Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (10 PDB entries)
    Uniprot P09186
  8. 2045953Domain d1rrlb2: 1rrl B:8-167 [111929]
    Other proteins in same PDB: d1rrla1, d1rrlb1
    complexed with fe2

Details for d1rrlb2

PDB Entry: 1rrl (more details), 2.09 Å

PDB Description: soybean lipoxygenase (lox-3) at 93k at 2.0 a resolution
PDB Compounds: (B:) Seed lipoxygenase-3

SCOPe Domain Sequences for d1rrlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrlb2 b.12.1.1 (B:8-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
rghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatk
adangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteffl
vsltledipnhgsihfvcnswiynaklfksdriffanqty

SCOPe Domain Coordinates for d1rrlb2:

Click to download the PDB-style file with coordinates for d1rrlb2.
(The format of our PDB-style files is described here.)

Timeline for d1rrlb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rrlb1