![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
![]() | Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) ![]() |
![]() | Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) |
![]() | Protein Plant lipoxigenase [49725] (2 species) |
![]() | Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (10 PDB entries) Uniprot P09186 |
![]() | Domain d1rrlb2: 1rrl B:8-167 [111929] Other proteins in same PDB: d1rrla1, d1rrlb1 complexed with fe2 |
PDB Entry: 1rrl (more details), 2.09 Å
SCOPe Domain Sequences for d1rrlb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rrlb2 b.12.1.1 (B:8-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]} rghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatk adangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteffl vsltledipnhgsihfvcnswiynaklfksdriffanqty
Timeline for d1rrlb2: