SCOPe 2.08: Domain d1rrlb2: 1rrl B:8-167

Lineage for d1rrlb2 (1rrl B:8-167)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins)

6. Protein Plant lipoxigenase [49725] (2 species)

7. Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (10 PDB entries)
   Uniprot P09186

8. Domain d1rrlb2: 1rrl B:8-167 [111929]
   Other proteins in same PDB: d1rrla1, d1rrlb1
   complexed with fe2

Details for d1rrlb2

PDB Entry: 1rrl, 2.09 Å

PDB Description: soybean lipoxygenase (lox-3) at 93k at 2.0 a resolution

PDB Compounds: (B:) Seed lipoxygenase-3

SCOPe Domain Sequences for d1rrlb2:

Sequence; same for both SEQRES and ATOM records:

>d1rrlb2 b.12.1.1 (B:8-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
rghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatk
adangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteffl
vsltledipnhgsihfvcnswiynaklfksdriffanqty

Timeline for d1rrlb2:

• d1rrlb2 first appeared in SCOP 1.71
  
• d1rrlb2 appears in SCOPe 2.07