Class b: All beta proteins [48724] (178 folds) |
Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology duplication: has weak internal pseudo twofold symmetry |
Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families) |
Family b.12.1.1: Lipoxigenase N-terminal domain [49724] (2 proteins) |
Protein Plant lipoxigenase [49725] (2 species) |
Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [49727] (10 PDB entries) Uniprot P09186 |
Domain d1rrla2: 1rrl A:8-167 [111927] Other proteins in same PDB: d1rrla1, d1rrlb1 complexed with fe2 |
PDB Entry: 1rrl (more details), 2.09 Å
SCOPe Domain Sequences for d1rrla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rrla2 b.12.1.1 (A:8-167) Plant lipoxigenase {Soybean (Glycine max), isozyme L3 [TaxId: 3847]} rghkikgtvvlmrknvldvnsvtsvggiigqgldlvgstldtltaflgrsvslqlisatk adangkgklgkatflegiitslptlgagqsafkinfewddgsgipgafyiknfmqteffl vsltledipnhgsihfvcnswiynaklfksdriffanqty
Timeline for d1rrla2: