Lineage for d1rrla1 (1rrl A:168-857)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 647641Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 647642Superfamily a.119.1: Lipoxigenase [48484] (2 families) (S)
  5. 647643Family a.119.1.1: Plant lipoxigenases [48485] (1 protein)
  6. 647644Protein Lipoxigenase, C-terminal domain [48486] (2 species)
    N-terminal domain is beta-sandwich similar to colipase-binding domain of pancreatic lipase
    contains alpha plus beta subdomain: res. 341-495; alpha-beta(5)-alpha
  7. 647656Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [48488] (9 PDB entries)
  8. 647664Domain d1rrla1: 1rrl A:168-857 [111926]
    Other proteins in same PDB: d1rrla2, d1rrlb2

Details for d1rrla1

PDB Entry: 1rrl (more details), 2.09 Å

PDB Description: soybean lipoxygenase (lox-3) at 93k at 2.0 a resolution
PDB Compounds: (A:) Seed lipoxygenase-3

SCOP Domain Sequences for d1rrla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrla1 a.119.1.1 (A:168-857) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
lpsetpaplvkyreeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggn
dtfpyprrgrtgrkptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpl
lqsafdlnftprefdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpp
pkviqvsksawmtdeefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehle
pnlegltvdeaiqnkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplai
elslphpqgdqsgafsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavve
pfiiatnrhlsvvhpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsa
vvykdwvftdqalpadlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvhey
vflyyksddtlredpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasa
lhaavnfgqypygglilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidl
svieilsrhasdevylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnr
cgpvqmpytlllpsskegltfrgipnsisi

SCOP Domain Coordinates for d1rrla1:

Click to download the PDB-style file with coordinates for d1rrla1.
(The format of our PDB-style files is described here.)

Timeline for d1rrla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rrla2