Lineage for d1rrla1 (1rrl A:168-857)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008080Fold a.119: Lipoxigenase [48483] (1 superfamily)
    multihelical
    large nearly all-alpha domain
  4. 2008081Superfamily a.119.1: Lipoxigenase [48484] (3 families) (S)
  5. 2008082Family a.119.1.1: Plant lipoxigenases [48485] (2 protein domains)
    automatically mapped to Pfam PF00305
  6. 2008083Protein Lipoxigenase, C-terminal domain [48486] (2 species)
    N-terminal domain is beta-sandwich similar to colipase-binding domain of pancreatic lipase
    contains alpha plus beta subdomain: res. 341-495; alpha-beta(5)-alpha
  7. 2008103Species Soybean (Glycine max), isozyme L3 [TaxId:3847] [48488] (10 PDB entries)
    Uniprot P09186
  8. 2008111Domain d1rrla1: 1rrl A:168-857 [111926]
    Other proteins in same PDB: d1rrla2, d1rrlb2
    complexed with fe2

Details for d1rrla1

PDB Entry: 1rrl (more details), 2.09 Å

PDB Description: Soybean Lipoxygenase (LOX-3) at 93K at 2.0 A resolution
PDB Compounds: (A:) Seed lipoxygenase-3

SCOPe Domain Sequences for d1rrla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rrla1 a.119.1.1 (A:168-857) Lipoxigenase, C-terminal domain {Soybean (Glycine max), isozyme L3 [TaxId: 3847]}
lpsetpaplvkyreeelhnlrgdgtgerkeweriydydvyndlgdpdkgenharpvlggn
dtfpyprrgrtgrkptrkdpnsesrsndvylprdeafghlkssdfltyglksvsqnvlpl
lqsafdlnftprefdsfdevhglysggiklptdiiskisplpvlkeifrtdgeqalkfpp
pkviqvsksawmtdeefaremlagvnpnlirclkdfpprskldsqvygdhtsqitkehle
pnlegltvdeaiqnkrlflldhhdpimpylrrinatstkayatrtilflkndgtlrplai
elslphpqgdqsgafsqvflpadegvessiwllakayvvvndscyhqlvshwlnthavve
pfiiatnrhlsvvhpiykllhphyrdtmninglarlslvndggvieqtflwgrysvemsa
vvykdwvftdqalpadlikrgmaiedpscphgirlviedypytvdgleiwdaiktwvhey
vflyyksddtlredpelqacwkelvevghgdkknepwwpkmqtreelveacaiiiwtasa
lhaavnfgqypygglilnrptlsrrfmpekgsaeyeelrknpqkaylktitpkfqtlidl
svieilsrhasdevylgerdnpnwtsdtraleafkrfgnklaqienklsernndeklrnr
cgpvqmpytlllpsskegltfrgipnsisi

SCOPe Domain Coordinates for d1rrla1:

Click to download the PDB-style file with coordinates for d1rrla1.
(The format of our PDB-style files is described here.)

Timeline for d1rrla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rrla2