Lineage for d1rqfk_ (1rqf K:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 624613Fold g.41: Rubredoxin-like [57769] (14 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 624723Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) (S)
  5. 624724Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein)
    contains alpha-helices in the N- and C-terminal extensions (linkers?)
  6. 624725Protein Casein kinase II beta subunit [57800] (2 species)
  7. 624726Species African clawed frog (Xenopus laevis) [TaxId:8355] [118288] (1 PDB entry)
  8. 624734Domain d1rqfk_: 1rqf K: [111921]
    complexed with zn

Details for d1rqfk_

PDB Entry: 1rqf (more details), 2.89 Å

PDB Description: structure of ck2 beta subunit crystallized in the presence of a p21waf1 peptide

SCOP Domain Sequences for d1rqfk_:

Sequence, based on SEQRES records: (download)

>d1rqfk_ g.41.4.1 (K:) Casein kinase II beta subunit {African clawed frog (Xenopus laevis)}
ssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdee
lednpnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlp
iglsdipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkr

Sequence, based on observed residues (ATOM records): (download)

>d1rqfk_ g.41.4.1 (K:) Casein kinase II beta subunit {African clawed frog (Xenopus laevis)}
ssseevswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepnqs
dlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpiglsdipg
eamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkr

SCOP Domain Coordinates for d1rqfk_:

Click to download the PDB-style file with coordinates for d1rqfk_.
(The format of our PDB-style files is described here.)

Timeline for d1rqfk_: