![]() | Class g: Small proteins [56992] (100 folds) |
![]() | Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
![]() | Superfamily g.41.4: Casein kinase II beta subunit [57798] (1 family) ![]() automatically mapped to Pfam PF01214 |
![]() | Family g.41.4.1: Casein kinase II beta subunit [57799] (1 protein) contains alpha-helices in the N- and C-terminal extensions (linkers?) |
![]() | Protein Casein kinase II beta subunit [57800] (3 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [118288] (1 PDB entry) Uniprot P28021 7-178 # 100% identical to the human enzyme (Uniprot P13862 7-178) |
![]() | Domain d1rqfj_: 1rqf J: [111920] complexed with unk, zn |
PDB Entry: 1rqf (more details), 2.89 Å
SCOPe Domain Sequences for d1rqfj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqfj_ g.41.4.1 (J:) Casein kinase II beta subunit {African clawed frog (Xenopus laevis) [TaxId: 8355]} evswiswfcglrgneffcevdedyiqdkfnltglneqvphyrqaldmildlepdeeledn pnqsdlieqaaemlygliharyiltnrgiaqmlekyqqgdfgycprvycenqpmlpigls dipgeamvklycpkcmdvytpkssrhhhtdgayfgtgfphmlfmvhpeyrpkr
Timeline for d1rqfj_: