![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [46487] (253 PDB entries) Uniprot P69905 P01922 P01934 P01935 |
![]() | Domain d1rqac_: 1rqa C: [111912] Other proteins in same PDB: d1rqab_, d1rqad_ complexed with hem, no |
PDB Entry: 1rqa (more details), 2.11 Å
SCOPe Domain Sequences for d1rqac_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rqac_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]} vlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa vhasldkflasvstvltskyr
Timeline for d1rqac_: