Lineage for d1rqab_ (1rqa B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1715732Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1715733Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1715807Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 1716690Protein Hemoglobin, beta-chain [46500] (24 species)
  7. 1716811Species Human (Homo sapiens) [TaxId:9606] [46501] (225 PDB entries)
    Uniprot P68871
  8. 1717036Domain d1rqab_: 1rqa B: [111911]
    Other proteins in same PDB: d1rqaa_, d1rqac_
    complexed with hem, no

Details for d1rqab_

PDB Entry: 1rqa (more details), 2.11 Å

PDB Description: Crystallographic Analysis of the Interaction of Nitric Oxide with Quaternary-T Human Hemoglobin. Beta W73E hemoglobin exposed to NO under anaerobic conditions
PDB Compounds: (B:) hemoglobin beta chain

SCOPe Domain Sequences for d1rqab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rqab_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypetqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOPe Domain Coordinates for d1rqab_:

Click to download the PDB-style file with coordinates for d1rqab_.
(The format of our PDB-style files is described here.)

Timeline for d1rqab_: