![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.15: Rps17e-like [116820] (1 family) ![]() automatically mapped to Pfam PF00833 |
![]() | Family a.4.15.1: Rps17e-like [116821] (1 protein) Pfam PF00833 |
![]() | Protein ribosomal protein S17e [116822] (1 species) |
![]() | Species Methanobacterium thermoautotrophicum [TaxId:145262] [116823] (1 PDB entry) Uniprot O26894; MTH803 |
![]() | Domain d1rq6a_: 1rq6 A: [111907] Structural genomics target |
PDB Entry: 1rq6 (more details)
SCOPe Domain Sequences for d1rq6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rq6a_ a.4.15.1 (A:) ribosomal protein S17e {Methanobacterium thermoautotrophicum [TaxId: 145262]} mgnirtsfvkriakemiethpgkftddfdtnkklveefstvstkhlrnkiagyitriisq qk
Timeline for d1rq6a_: