SCOP 1.73: Domain d1rq6a_: 1rq6 A:

Lineage for d1rq6a_ (1rq6 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.15: Rps17e-like [116820] (1 family)

5. Family a.4.15.1: Rps17e-like [116821] (1 protein)
   Pfam PF00833

6. Protein ribosomal protein S17e [116822] (1 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [116823] (1 PDB entry)

8. Domain d1rq6a_: 1rq6 A: [111907]
   Structural genomics target

Details for d1rq6a_

PDB Entry: 1rq6

PDB Description: solution structure of ribosomal protein s17e from methanobacterium thermoautotrophicum, northeast structural genomics consortium target tt802 / ontario center for structural proteomics target mth0803

PDB Compounds: (A:) 30S ribosomal protein S17e

SCOP Domain Sequences for d1rq6a_:

Sequence; same for both SEQRES and ATOM records:

>d1rq6a_ a.4.15.1 (A:) ribosomal protein S17e {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mgnirtsfvkriakemiethpgkftddfdtnkklveefstvstkhlrnkiagyitriisq
qk

Timeline for d1rq6a_:

• d1rq6a_ first appeared in SCOP 1.71
  
• d1rq6a_ appears in SCOP 1.75
  
• d1rq6a_ appears in the current release, SCOPe 2.08