Lineage for d1rq6a_ (1rq6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2696004Superfamily a.4.15: Rps17e-like [116820] (1 family) (S)
    automatically mapped to Pfam PF00833
  5. 2696005Family a.4.15.1: Rps17e-like [116821] (1 protein)
    Pfam PF00833
  6. 2696006Protein ribosomal protein S17e [116822] (1 species)
  7. 2696007Species Methanobacterium thermoautotrophicum [TaxId:145262] [116823] (1 PDB entry)
    Uniprot O26894; MTH803
  8. 2696008Domain d1rq6a_: 1rq6 A: [111907]
    Structural genomics target

Details for d1rq6a_

PDB Entry: 1rq6 (more details)

PDB Description: solution structure of ribosomal protein s17e from methanobacterium thermoautotrophicum, northeast structural genomics consortium target tt802 / ontario center for structural proteomics target mth0803
PDB Compounds: (A:) 30S ribosomal protein S17e

SCOPe Domain Sequences for d1rq6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rq6a_ a.4.15.1 (A:) ribosomal protein S17e {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mgnirtsfvkriakemiethpgkftddfdtnkklveefstvstkhlrnkiagyitriisq
qk

SCOPe Domain Coordinates for d1rq6a_:

Click to download the PDB-style file with coordinates for d1rq6a_.
(The format of our PDB-style files is described here.)

Timeline for d1rq6a_: