Lineage for d1rosb_ (1ros B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571026Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2571027Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2571099Domain d1rosb_: 1ros B: [111904]
    complexed with ca, deo, zn

Details for d1rosb_

PDB Entry: 1ros (more details), 2 Å

PDB Description: crystal structure of mmp-12 complexed to 2-(1,3-dioxo-1,3-dihydro-2h- isoindol-2-yl)ethyl-4-(4-ethoxy[1,1-biphenyl]-4-yl)-4-oxobutanoic acid
PDB Compounds: (B:) Macrophage metalloelastase

SCOPe Domain Sequences for d1rosb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rosb_ d.92.1.11 (B:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd

SCOPe Domain Coordinates for d1rosb_:

Click to download the PDB-style file with coordinates for d1rosb_.
(The format of our PDB-style files is described here.)

Timeline for d1rosb_: