SCOP 1.75: Domain d1rosa_: 1ros A:

Lineage for d1rosa_ (1ros A:)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (17 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (13 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (18 PDB entries)
   Uniprot P39900 106-263
   Uniprot P39900 106-264
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d1rosa_: 1ros A: [111903]

Details for d1rosa_

PDB Entry: 1ros, 2 Å

PDB Description: crystal structure of mmp-12 complexed to 2-(1,3-dioxo-1,3-dihydro-2h- isoindol-2-yl)ethyl-4-(4-ethoxy[1,1-biphenyl]-4-yl)-4-oxobutanoic acid

PDB Compounds: (A:) Macrophage metalloelastase

SCOP Domain Sequences for d1rosa_:

Sequence; same for both SEQRES and ATOM records:

>d1rosa_ d.92.1.11 (A:) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslygd

Timeline for d1rosa_:

• d1rosa_ first appeared in SCOP 1.71
  
• d1rosa_ appears in SCOP 1.73
  
• d1rosa_ appears in SCOPe 2.01
  
• d1rosa_ appears in the current release, SCOPe 2.08