SCOP 1.71: Domain d1rora_: 1ror A:

Lineage for d1rora_ (1ror A:)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (3 families)

5. Family a.211.1.2: PDEase [48548] (6 proteins)
   Pfam 00233; multihelical; can be divided into three subdomains

6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48550] (14 PDB entries)

8. Domain d1rora_: 1ror A: [111901]

Details for d1rora_

PDB Entry: 1ror, 2 Å

PDB Description: crystal structures of the catalytic domain of phosphodiesterase 4b2b complexed with amp

SCOP Domain Sequences for d1rora_:

Sequence; same for both SEQRES and ATOM records:

>d1rora_ a.211.1.2 (A:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens)}
sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri
ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa
aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr
qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca
dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv
hplwetwadlvqpdaqdildtlednrnwyqsmipqapa

Timeline for d1rora_:

• d1rora_ is new in SCOP 1.71
  
• d1rora_ appears in SCOP 1.73
  
• d1rora_ appears in the current release, SCOPe 2.08