Class a: All alpha proteins [46456] (290 folds) |
Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) |
Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
Protein Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b [48549] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [48550] (31 PDB entries) Uniprot Q07343 324-667 |
Domain d1ro6b_: 1ro6 B: [111898] complexed with ars, mn, rol, zn |
PDB Entry: 1ro6 (more details), 2 Å
SCOPe Domain Sequences for d1ro6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ro6b_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase 4b2b {Human (Homo sapiens) [TaxId: 9606]} sisrfgvntenedhlakeledlnkwglnifnvagyshnrpltcimyaifqerdllktfri ssdtfitymmtledhyhsdvayhnslhaadvaqsthvllstpaldavftdleilaaifaa aihdvdhpgvsnqflintnselalmyndesvlenhhlavgfkllqeehcdifmnltkkqr qtlrkmvidmvlatdmskhmslladlktmvetkkvtssgvllldnytdriqvlrnmvhca dlsnptkslelyrqwtdrimeeffqqgdkerergmeispmcdkhtasveksqvgfidyiv hplwetwadlvqpdaqdildtlednrnwyqsmipqapappldeq
Timeline for d1ro6b_: