Lineage for d1rmza1 (1rmz A:106-263)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2570195Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2570196Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 2570846Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2571026Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2571027Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2571032Domain d1rmza1: 1rmz A:106-263 [111896]
    Other proteins in same PDB: d1rmza2
    complexed with ca, ngh, zn

Details for d1rmza1

PDB Entry: 1rmz (more details), 1.34 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor nngh at 1.3 a resolution
PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d1rmza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmza1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

SCOPe Domain Coordinates for d1rmza1:

Click to download the PDB-style file with coordinates for d1rmza1.
(The format of our PDB-style files is described here.)

Timeline for d1rmza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rmza2