SCOPe 2.08: Domain d1rmza1: 1rmz A:106-263

Lineage for d1rmza1 (1rmz A:106-263)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein Macrophage elastase (MMP-12) [69780] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
   Uniprot P39900 106-263 ! Uniprot P39900 106-264

8. Domain d1rmza1: 1rmz A:106-263 [111896]
   Other proteins in same PDB: d1rmza2
   complexed with ca, ngh, zn

Details for d1rmza1

PDB Entry: 1rmz, 1.34 Å

PDB Description: crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor nngh at 1.3 a resolution

PDB Compounds: (A:) Macrophage metalloelastase

SCOPe Domain Sequences for d1rmza1:

Sequence; same for both SEQRES and ATOM records:

>d1rmza1 d.92.1.11 (A:106-263) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg

Timeline for d1rmza1:

• d1rmza1 first appeared in SCOP 1.71, called d1rmza_
  
• d1rmza1 appears in SCOPe 2.07