SCOP 1.73: Domain d1rmyb_: 1rmy B:

Lineage for d1rmyb_ (1rmy B:)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (23 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Escherichia coli [TaxId:562] [102309] (8 PDB entries)

8. Domain d1rmyb_: 1rmy B: [111895]
   complexed with dcz, mg, po4

Details for d1rmyb_

PDB Entry: 1rmy, 1.75 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with deoxycytosine and phosphate bound to the catalytic metal

PDB Compounds: (B:) Class B acid phosphatase

SCOP Domain Sequences for d1rmyb_:

Sequence; same for both SEQRES and ATOM records:

>d1rmyb_ c.108.1.12 (B:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

Timeline for d1rmyb_:

• d1rmyb_ first appeared in SCOP 1.71
  
• d1rmyb_ appears in SCOP 1.75
  
• d1rmyb_ appears in the current release, SCOPe 2.08