SCOP 1.75: Domain d1rmya_: 1rmy A:

Lineage for d1rmya_ (1rmy A:)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (25 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
   the insertion subdomain is a helical hairpin

6. Protein Class B acid phosphatase, AphA [102308] (2 species)

7. Species Escherichia coli [TaxId:562] [102309] (10 PDB entries)
   Uniprot P32697 27-237

8. Domain d1rmya_: 1rmy A: [111894]

Details for d1rmya_

PDB Entry: 1rmy, 1.75 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with deoxycytosine and phosphate bound to the catalytic metal

PDB Compounds: (A:) Class B acid phosphatase

SCOP Domain Sequences for d1rmya_:

Sequence; same for both SEQRES and ATOM records:

>d1rmya_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
splnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkktf
spesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetvs
ktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgargi
rilrasnstykplpqagafgeevivnsey

Timeline for d1rmya_:

• d1rmya_ first appeared in SCOP 1.71
  
• d1rmya_ appears in SCOP 1.73
  
• d1rmya_ appears in SCOPe 2.01
  
• d1rmya_ appears in the current release, SCOPe 2.08