Lineage for d1rmta_ (1rmt A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712479Family c.108.1.12: Class B acid phosphatase, AphA [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 712480Protein Class B acid phosphatase, AphA [102308] (2 species)
  7. 712481Species Escherichia coli [TaxId:562] [102309] (8 PDB entries)
  8. 712484Domain d1rmta_: 1rmt A: [111888]

Details for d1rmta_

PDB Entry: 1rmt (more details), 1.4 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase complexed with adenosine.
PDB Compounds: (A:) Class B acid phosphatase

SCOP Domain Sequences for d1rmta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rmta_ c.108.1.12 (A:) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]}
psplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkkt
fspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktetv
sktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgarg
irilrasnstykplpqagafgeevivnsey

SCOP Domain Coordinates for d1rmta_:

Click to download the PDB-style file with coordinates for d1rmta_.
(The format of our PDB-style files is described here.)

Timeline for d1rmta_: