Lineage for d1rm7a_ (1rm7 A:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594610Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 594611Superfamily c.108.1: HAD-like [56784] (18 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 594792Family c.108.1.12: Class B acid phosphatase [102307] (1 protein)
    the insertion subdomain is a helical hairpin
  6. 594793Protein Class B acid phosphatase [102308] (1 species)
  7. 594794Species Escherichia coli [TaxId:562] [102309] (7 PDB entries)
  8. 594804Domain d1rm7a_: 1rm7 A: [111884]

Details for d1rm7a_

PDB Entry: 1rm7 (more details), 2.03 Å

PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate at 2 A resolution

SCOP Domain Sequences for d1rm7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm7a_ c.108.1.12 (A:) Class B acid phosphatase {Escherichia coli}
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey

SCOP Domain Coordinates for d1rm7a_:

Click to download the PDB-style file with coordinates for d1rm7a_.
(The format of our PDB-style files is described here.)

Timeline for d1rm7a_:

  • d1rm7a_ is new in SCOP 1.71
  • d1rm7a_ does not appear in SCOP 1.73

View in 3D
Domains from other chains:
(mouse over for more information)
d1rm7c_