Lineage for d1rm7a_ (1rm7 A:)
- Root: SCOP 1.71
Class c: Alpha and beta proteins (a/b) [51349] (134 folds) 
Fold c.108: HAD-like [56783] (1 superfamily)
3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456Superfamily c.108.1: HAD-like [56784] (18 families) 
usually contains an insertion (sub)domain after strand 1
Family c.108.1.12: Class B acid phosphatase [102307] (1 protein)
the insertion subdomain is a helical hairpinProtein Class B acid phosphatase [102308] (1 species) Species Escherichia coli [TaxId:562] [102309] (7 PDB entries) 
Domain d1rm7a_: 1rm7 A: [111884]
Details for d1rm7a_
PDB Entry: 1rm7 (more details), 2.03 Å
PDB Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate at 2 A resolution
SCOP Domain Sequences for d1rm7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rm7a_ c.108.1.12 (A:) Class B acid phosphatase {Escherichia coli}
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey
SCOP Domain Coordinates for d1rm7a_:
Click to download the PDB-style file with coordinates for d1rm7a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1rm7a_:
- d1rm7a_ is new in SCOP 1.71
- d1rm7a_ does not appear in SCOP 1.73
View in 3D
