Lineage for d1rm6f1 (1rm6 F:82-157)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737421Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 1737422Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 1737423Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 1737424Protein 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, C-terminal domain [116919] (1 species)
  7. 1737425Species Thauera aromatica [TaxId:59405] [116920] (2 PDB entries)
    Uniprot O33818
  8. 1737427Domain d1rm6f1: 1rm6 F:82-157 [111882]
    Other proteins in same PDB: d1rm6a1, d1rm6a2, d1rm6b1, d1rm6b2, d1rm6c2, d1rm6d1, d1rm6d2, d1rm6e1, d1rm6e2, d1rm6f2
    complexed with cl, epe, fad, fes, k, na, pcd, sf4, so4

Details for d1rm6f1

PDB Entry: 1rm6 (more details), 1.6 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (F:) 4-hydroxybenzoyl-CoA reductase gamma subunit

SCOPe Domain Sequences for d1rm6f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm6f1 a.56.1.1 (F:82-157) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, C-terminal domain {Thauera aromatica [TaxId: 59405]}
qgtlsklqaafheklgtqcgfctpgmimaseallrknpspsrdeikaalagnlcrctgyv
kiiksvetaaaarlce

SCOPe Domain Coordinates for d1rm6f1:

Click to download the PDB-style file with coordinates for d1rm6f1.
(The format of our PDB-style files is described here.)

Timeline for d1rm6f1: