Lineage for d1rm6e2 (1rm6 E:1-216)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1675721Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 1675722Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 1675806Family d.145.1.3: CO dehydrogenase flavoprotein N-terminal domain-like [56187] (6 proteins)
    automatically mapped to Pfam PF00941
  6. 1675807Protein 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-terminal domain [118141] (1 species)
  7. 1675808Species Thauera aromatica [TaxId:59405] [118142] (2 PDB entries)
    Uniprot O33820
  8. 1675810Domain d1rm6e2: 1rm6 E:1-216 [111881]
    Other proteins in same PDB: d1rm6a1, d1rm6a2, d1rm6b1, d1rm6c1, d1rm6c2, d1rm6d1, d1rm6d2, d1rm6e1, d1rm6f1, d1rm6f2
    complexed with cl, epe, fad, fes, k, na, pcd, sf4, so4

Details for d1rm6e2

PDB Entry: 1rm6 (more details), 1.6 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica
PDB Compounds: (E:) 4-hydroxybenzoyl-CoA reductase beta subunit

SCOPe Domain Sequences for d1rm6e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm6e2 d.145.1.3 (E:1-216) 4-hydroxybenzoyl-CoA reductase beta subunit HrcB, N-terminal domain {Thauera aromatica [TaxId: 59405]}
mniltdfrthrpatladavnalaaeatlplgagtdllpnlrrglghpaalvdltgidgla
tistladgslrigagatleaiaehdairttwpalaqaaesvagpthraaatlggnlcqdt
rctfynqsewwrsgngyclkykgdkchvivksdrcyatyhgdvapalmvldaraeivgpa
gkrtvpvaqlfresgaehltlekgellaaievpptg

SCOPe Domain Coordinates for d1rm6e2:

Click to download the PDB-style file with coordinates for d1rm6e2.
(The format of our PDB-style files is described here.)

Timeline for d1rm6e2: