Lineage for d1rm6d2 (1rm6 D:134-768)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 611247Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 611248Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 611249Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (6 proteins)
  6. 611250Protein 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, C-terminal domain [118109] (1 species)
  7. 611251Species Thauera aromatica [TaxId:59405] [118110] (2 PDB entries)
  8. 611253Domain d1rm6d2: 1rm6 D:134-768 [111879]
    Other proteins in same PDB: d1rm6a1, d1rm6b1, d1rm6b2, d1rm6c1, d1rm6c2, d1rm6d1, d1rm6e1, d1rm6e2, d1rm6f1, d1rm6f2
    complexed with cl, epe, fad, fes, fs4, k, na, pcd, so4

Details for d1rm6d2

PDB Entry: 1rm6 (more details), 1.6 Å

PDB Description: Structure of 4-hydroxybenzoyl-CoA reductase from Thauera aromatica

SCOP Domain Sequences for d1rm6d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rm6d2 d.133.1.1 (D:134-768) 4-hydroxybenzoyl-CoA reductase alpha subunit HrcA, C-terminal domain {Thauera aromatica}
mtpkaamkagaialhddkpnnilrevhaefgdvaaafaeadlirektytfaevnhvhmel
natlaeydpvrdmltlntttqvpyyvhlkvaaclqmdsarirvikpflgggfgartealh
feiiagllarkakgtvrllqtreetfiahrgrpwtevkmkiglkkdgkiaalaleatqag
gayagygiitilytgalmhglyhipaikhdawrvytntppcgamrghgtvdtraafeall
temgeelgidslkirqinmlpqipyvtmyaqrvmsygvpeclekvkaasgweerkgklpk
grglgialshfvsgtstpkhwtgephatvnlkldfdggitlltgaadigqgsntmasqva
aevlgvrlsrirvisadsaltpkdngsyssrvtfmvgnasisaaeelkgvlvkaaakkld
areedievidemfmvsgsqdpglsfqevvkaamvdsgtitvkgtytcptefqgdkkirgs
aigatmgfcyaaqvveasvdeitgkvtahkvwvavdvgkalnplavegqtqggvwmgmgq
alseetvydngrmvhgnildyrvptivespdieviivesmdpngpfgakeasegmlagfl
paiheavyeavgvratdfplspdritelldakeaa

SCOP Domain Coordinates for d1rm6d2:

Click to download the PDB-style file with coordinates for d1rm6d2.
(The format of our PDB-style files is described here.)

Timeline for d1rm6d2: