Lineage for d1rltb_ (1rlt B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 847927Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 847928Superfamily c.108.1: HAD-like [56784] (25 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 848143Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 848197Protein Sugar phosphatase SupH (YbiV) [117503] (1 species)
  7. 848198Species Escherichia coli [TaxId:562] [117504] (3 PDB entries)
    Uniprot P75792
  8. 848208Domain d1rltb_: 1rlt B: [111869]

Details for d1rltb_

PDB Entry: 1rlt (more details), 2.2 Å

PDB Description: transition state analogue of ybiv from e. coli k12
PDB Compounds: (B:) phosphatase

SCOP Domain Sequences for d1rltb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rltb_ c.108.1.10 (B:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}
vkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkdei
sfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeaf
valmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgf
idliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqi
aryatddnnhegalnviqavldntypfn

SCOP Domain Coordinates for d1rltb_:

Click to download the PDB-style file with coordinates for d1rltb_.
(The format of our PDB-style files is described here.)

Timeline for d1rltb_: