Lineage for d1rlta_ (1rlt A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2166914Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2166915Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2167325Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2167375Protein Sugar phosphatase SupH (YbiV) [117503] (1 species)
  7. 2167376Species Escherichia coli [TaxId:562] [117504] (3 PDB entries)
    Uniprot P75792
  8. 2167385Domain d1rlta_: 1rlt A: [111868]
    complexed with act, af3, gol, mg

Details for d1rlta_

PDB Entry: 1rlt (more details), 2.2 Å

PDB Description: transition state analogue of ybiv from e. coli k12
PDB Compounds: (A:) phosphatase

SCOPe Domain Sequences for d1rlta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlta_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}
vkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkdei
sfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeaf
valmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgf
idliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqi
aryatddnnhegalnviqavldntypfn

SCOPe Domain Coordinates for d1rlta_:

Click to download the PDB-style file with coordinates for d1rlta_.
(The format of our PDB-style files is described here.)

Timeline for d1rlta_: