Lineage for d1rlod_ (1rlo D:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712401Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 712455Protein Sugar phosphatase SupH (YbiV) [117503] (1 species)
  7. 712456Species Escherichia coli [TaxId:562] [117504] (3 PDB entries)
  8. 712464Domain d1rlod_: 1rlo D: [111867]
    complexed with bfd, gol, mg; mutant

Details for d1rlod_

PDB Entry: 1rlo (more details), 2 Å

PDB Description: phospho-aspartyl intermediate analogue of ybiv from e. coli k12
PDB Compounds: (D:) phosphatase

SCOP Domain Sequences for d1rlod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlod_ c.108.1.10 (D:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}
vkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkdei
sfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeaf
valmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgf
idliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqi
aryatddnnhegalnviqavldntypfn

SCOP Domain Coordinates for d1rlod_:

Click to download the PDB-style file with coordinates for d1rlod_.
(The format of our PDB-style files is described here.)

Timeline for d1rlod_: