Lineage for d1rloc_ (1rlo C:)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 594610Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 594611Superfamily c.108.1: HAD-like [56784] (18 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 594745Family c.108.1.10: Predicted hydrolases Cof [82388] (6 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 594771Protein Sugar phosphatase SupH (YbiV) [117503] (1 species)
  7. 594772Species Escherichia coli [TaxId:562] [117504] (3 PDB entries)
  8. 594779Domain d1rloc_: 1rlo C: [111866]

Details for d1rloc_

PDB Entry: 1rlo (more details), 2 Å

PDB Description: Phospho-aspartyl Intermediate Analogue of ybiV from E. coli K12

SCOP Domain Sequences for d1rloc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rloc_ c.108.1.10 (C:) Sugar phosphatase SupH (YbiV) {Escherichia coli}
vkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkdei
sfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapeaf
valmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfgf
idliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikqi
aryatddnnhegalnviqavldntypfn

SCOP Domain Coordinates for d1rloc_:

Click to download the PDB-style file with coordinates for d1rloc_.
(The format of our PDB-style files is described here.)

Timeline for d1rloc_: