Lineage for d1rlmc_ (1rlm C:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2526731Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2526732Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2527199Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 2527250Protein Sugar phosphatase SupH (YbiV) [117503] (1 species)
  7. 2527251Species Escherichia coli [TaxId:562] [117504] (3 PDB entries)
    Uniprot P75792
  8. 2527258Domain d1rlmc_: 1rlm C: [111862]
    complexed with gol, mg

Details for d1rlmc_

PDB Entry: 1rlm (more details), 1.9 Å

PDB Description: crystal structure of ybiv from escherichia coli k12
PDB Compounds: (C:) phosphatase

SCOPe Domain Sequences for d1rlmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlmc_ c.108.1.10 (C:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}
avkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkde
isfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapea
fvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfg
fidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikq
iaryatddnnhegalnviqavldntypfn

SCOPe Domain Coordinates for d1rlmc_:

Click to download the PDB-style file with coordinates for d1rlmc_.
(The format of our PDB-style files is described here.)

Timeline for d1rlmc_: