Lineage for d1rlma_ (1rlm A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712401Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 712455Protein Sugar phosphatase SupH (YbiV) [117503] (1 species)
  7. 712456Species Escherichia coli [TaxId:562] [117504] (3 PDB entries)
  8. 712457Domain d1rlma_: 1rlm A: [111860]

Details for d1rlma_

PDB Entry: 1rlm (more details), 1.9 Å

PDB Description: crystal structure of ybiv from escherichia coli k12
PDB Compounds: (A:) phosphatase

SCOP Domain Sequences for d1rlma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]}
avkvivtdmdgtflndaktynqprfmaqyqelkkrgikfvvasgnqyyqlisffpelkde
isfvaengalvyehgkqlfhgeltrhesrivigellkdkqlnfvacglqsayvsenapea
fvalmakhyhrlkpvkdyqeiddvlfkfslnlpdeqiplvidklhvaldgimkpvtsgfg
fidliipglhkangisrllkrwdlspqnvvaigdsgndaemlkmarysfamgnaaenikq
iaryatddnnhegalnviqavldntypfn

SCOP Domain Coordinates for d1rlma_:

Click to download the PDB-style file with coordinates for d1rlma_.
(The format of our PDB-style files is described here.)

Timeline for d1rlma_: