Lineage for d1rl0a_ (1rl0 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000033Protein Dianthin 30 [103335] (1 species)
  7. 3000034Species Clove pink (Dianthus caryophyllus) [TaxId:3570] [103336] (4 PDB entries)
    Uniprot P24476 24-278
  8. 3000035Domain d1rl0a_: 1rl0 A: [111859]

Details for d1rl0a_

PDB Entry: 1rl0 (more details), 1.4 Å

PDB Description: Crystal structure of a new ribosome-inactivating protein (RIP): dianthin 30
PDB Compounds: (A:) Antiviral protein DAP-30

SCOPe Domain Sequences for d1rl0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rl0a_ d.165.1.1 (A:) Dianthin 30 {Clove pink (Dianthus caryophyllus) [TaxId: 3570]}
ataytlnlanpsasqyssfldqirnnvrdtsliyggtdvavigapsttdkflrlnfqgpr
gtvslglrrenlyvvaylamdnanvnrayyfknqitsaeltalfpevvvanqkqleyged
yqaieknakittgdqsrkelglginllitmidgvnkkvrvvkdearflliaiqmtaeaar
fryiqnlvtknfpnkfdsenkviqfqvswskistaifgdckngvfnkdydfgfgkvrqak
dlqmgllkylgrpks

SCOPe Domain Coordinates for d1rl0a_:

Click to download the PDB-style file with coordinates for d1rl0a_.
(The format of our PDB-style files is described here.)

Timeline for d1rl0a_: