![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species) |
![]() | Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (2 PDB entries) |
![]() | Domain d1rkya3: 1rky A:170-315 [111858] Other proteins in same PDB: d1rkya1 complexed with ca, cl, cu, imd, man, mg, nag, xe |
PDB Entry: 1rky (more details), 1.68 Å
SCOP Domain Sequences for d1rkya3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rkya3 d.17.2.1 (A:170-315) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris) [TaxId: 4922]} evghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvd ygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkdd fvtlpkidvdnldwtviqrndsapvr
Timeline for d1rkya3: