SCOP 1.71: Domain d1rkya3: 1rky A:170-315

Lineage for d1rkya3 (1rky A:170-315)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species)

7. Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (2 PDB entries)

8. Domain d1rkya3: 1rky A:170-315 [111858]
   Other proteins in same PDB: d1rkya1
   complexed with ca, cl, cu, imd, man, mg, nag, xe

Details for d1rkya3

PDB Entry: 1rky, 1.68 Å

PDB Description: pplo + xe

SCOP Domain Sequences for d1rkya3:

Sequence; same for both SEQRES and ATOM records:

>d1rkya3 d.17.2.1 (A:170-315) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris)}
evghldriksaakssflnknlnttimrdvlegligvpyedmgchsaapqlhdpatgatvd
ygtcnintendaenlvptgfffkfdmtgrdvsqwkmleyiynnkvytsaeelyeamqkdd
fvtlpkidvdnldwtviqrndsapvr

Timeline for d1rkya3:

• d1rkya3 is new in SCOP 1.71
  
• d1rkya3 appears in SCOP 1.73
  
• d1rkya3 appears in the current release, SCOPe 2.08