Lineage for d1rkya2 (1rky A:43-169)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718735Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 718736Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 718946Protein Lysyl oxidase PplO, domains 1 and 2 [102806] (1 species)
  7. 718947Species Yeast (Pichia pastoris) [TaxId:4922] [102807] (2 PDB entries)
  8. 718956Domain d1rkya2: 1rky A:43-169 [111857]
    Other proteins in same PDB: d1rkya1

Details for d1rkya2

PDB Entry: 1rky (more details), 1.68 Å

PDB Description: pplo + xe
PDB Compounds: (A:) lysyl oxidase

SCOP Domain Sequences for d1rkya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkya2 d.17.2.1 (A:43-169) Lysyl oxidase PplO, domains 1 and 2 {Yeast (Pichia pastoris) [TaxId: 4922]}
aecvsnenveieapktniwtslakeevqevldllhstynitevtkadffsnyvlwietlk
pnktealtyldedgdlpprnartvvyfgegeegyfeelkvgplpvsdettieplsfyntn
gksklpf

SCOP Domain Coordinates for d1rkya2:

Click to download the PDB-style file with coordinates for d1rkya2.
(The format of our PDB-style files is described here.)

Timeline for d1rkya2: