Lineage for d1rkya1 (1rky A:316-777)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044544Superfamily b.30.2: Amine oxidase catalytic domain [49998] (1 family) (S)
    automatically mapped to Pfam PF01179
  5. 2044545Family b.30.2.1: Amine oxidase catalytic domain [49999] (2 protein domains)
  6. 2044674Protein Lysyl oxidase PplO, domain 3 [101663] (1 species)
  7. 2044675Species Yeast (Pichia pastoris) [TaxId:4922] [101664] (3 PDB entries)
    Uniprot Q96X16 43-777
  8. 2044677Domain d1rkya1: 1rky A:316-777 [111856]
    Other proteins in same PDB: d1rkya2, d1rkya3
    complexed with ca, cl, cu, imd, mg, nag, xe

Details for d1rkya1

PDB Entry: 1rky (more details), 1.68 Å

PDB Description: pplo + xe
PDB Compounds: (A:) lysyl oxidase

SCOPe Domain Sequences for d1rkya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkya1 b.30.2.1 (A:316-777) Lysyl oxidase PplO, domain 3 {Yeast (Pichia pastoris) [TaxId: 4922]}
hlddrksprlvepegrrwaydgdeeyfswmdwgfytswsrdtgisfyditfkgerivyel
slqeliaeygsddpfnqhtfysdisygvgnrfslvpgydcpstagyfttdtfeydefynr
tlsycvfenqedysllrhtgasysaitqnptlnvrfistignydynflykffldgtlevs
vraagyiqagywnpetsapyglkihdvlsgsfhdhvlnykvdldvggtknrasqyvmkdv
dveypwapgtvyntkqiarevfenedfnginwpengqgilliesaeetnsfgnpraynim
pggggvhrivknsrsgpetqnwarsnlfltkhkdtelrsstalntnalydppvnfnafld
desldgedivawvnlglhhlpnsndlpntifstahasfmltpfnyfdsensrdttqqvfy
tyddeteesnwefygndwsscgvevaepnfedytygrgtrin

SCOPe Domain Coordinates for d1rkya1:

Click to download the PDB-style file with coordinates for d1rkya1.
(The format of our PDB-style files is described here.)

Timeline for d1rkya1: