Lineage for d1rkna_ (1rkn A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 558996Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 558997Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 558998Family b.40.1.1: Staphylococcal nuclease [50200] (1 protein)
    barrel, closed; n=5, S=10
  6. 558999Protein Staphylococcal nuclease [50201] (1 species)
  7. 559000Species Staphylococcus aureus [TaxId:1280] [50202] (67 PDB entries)
  8. 559065Domain d1rkna_: 1rkn A: [111855]
    OB-fold subdomain only
    mutant

Details for d1rkna_

PDB Entry: 1rkn (more details)

PDB Description: solution structure of 1-110 fragment of staphylococcal nuclease with g88w mutation

SCOP Domain Sequences for d1rkna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkna_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus}
atstkklhkepatlikaidgdtvklmykgqpmtfrlllvdtpetkhpkkgvekygpeasa
ftkkmvenakkievefdkgqrtdkygrwlayiyadgkmvnealvrqglak

SCOP Domain Coordinates for d1rkna_:

Click to download the PDB-style file with coordinates for d1rkna_.
(The format of our PDB-style files is described here.)

Timeline for d1rkna_: