Lineage for d1rkba_ (1rkb A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1162957Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1162962Protein Adenylate kinase [52554] (15 species)
  7. 1162996Species Human (Homo sapiens), isoenzyme 6 [TaxId:9606] [117527] (1 PDB entry)
    Uniprot Q9Y3D8
  8. 1162997Domain d1rkba_: 1rkb A: [111854]
    complexed with li, so4

Details for d1rkba_

PDB Entry: 1rkb (more details), 2 Å

PDB Description: The structure of adrenal gland protein AD-004
PDB Compounds: (A:) Protein AD-004

SCOPe Domain Sequences for d1rkba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]}
lmllpnilltgtpgvgkttlgkelasksglkyinvgdlareeqlydgydeeydcpilded
rvvdeldnqmreggvivdyhgcdffperwfhivfvlrtdtnvlyerletrgynekkltdn
iqceifqvlyeeatasykeeivhqlpsnkpeelennvdqilkwieqwikdhns

SCOPe Domain Coordinates for d1rkba_:

Click to download the PDB-style file with coordinates for d1rkba_.
(The format of our PDB-style files is described here.)

Timeline for d1rkba_: