Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein beta2-microglobulin [88600] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88603] (142 PDB entries) Uniprot P01887 |
Domain d1rk1b_: 1rk1 B: [111853] Other proteins in same PDB: d1rk1a1, d1rk1a2 complexed with nag; mutant |
PDB Entry: 1rk1 (more details), 2.1 Å
SCOPe Domain Sequences for d1rk1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rk1b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]} iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw sfyilahteftptetdtyacrvkhdsmaepktvywdrdm
Timeline for d1rk1b_: