Lineage for d1rk1a2 (1rk1 A:1-181)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600225Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 600226Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 600227Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins)
  6. 600255Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species)
  7. 600422Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries)
  8. 600439Domain d1rk1a2: 1rk1 A:1-181 [111852]
    Other proteins in same PDB: d1rk1a1, d1rk1b_
    complexed with fcb, nag; mutant

Details for d1rk1a2

PDB Entry: 1rk1 (more details), 2.1 Å

PDB Description: mhc class i natural h-2kb heavy chain complexed with beta-2 microglobulin and herpes simplex virus mutant glycoprotein b peptide

SCOP Domain Sequences for d1rk1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk1a2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB}
gphslryfvtavsrpglgeprymevgyvddtefvrfdsdaenpryeprarwmeqegpeyw
eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg
cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll
r

SCOP Domain Coordinates for d1rk1a2:

Click to download the PDB-style file with coordinates for d1rk1a2.
(The format of our PDB-style files is described here.)

Timeline for d1rk1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rk1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d1rk1b_