Lineage for d1rk1a1 (1rk1 A:182-274)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1758822Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1759808Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 1760095Species Mouse (Mus musculus) [TaxId:10090] [88606] (103 PDB entries)
    Uniprot P01901 22-299
  8. 1760123Domain d1rk1a1: 1rk1 A:182-274 [111851]
    Other proteins in same PDB: d1rk1a2, d1rk1b_
    complexed with nag; mutant

Details for d1rk1a1

PDB Entry: 1rk1 (more details), 2.1 Å

PDB Description: mhc class i natural h-2kb heavy chain complexed with beta-2 microglobulin and herpes simplex virus mutant glycoprotein b peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1rk1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk1a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d1rk1a1:

Click to download the PDB-style file with coordinates for d1rk1a1.
(The format of our PDB-style files is described here.)

Timeline for d1rk1a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rk1a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rk1b_