Lineage for d1rk0b_ (1rk0 B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548438Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries)
  8. 548494Domain d1rk0b_: 1rk0 B: [111850]
    Other proteins in same PDB: d1rk0a1, d1rk0a2
    complexed with nag

Details for d1rk0b_

PDB Entry: 1rk0 (more details), 2.61 Å

PDB Description: mhc class i h-2kb heavy chain complexed with beta-2 microglobulin and herpes simplex virus glycoprotein b peptide

SCOP Domain Sequences for d1rk0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk0b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus)}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1rk0b_:

Click to download the PDB-style file with coordinates for d1rk0b_.
(The format of our PDB-style files is described here.)

Timeline for d1rk0b_: