![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein Class I MHC, alpha-3 domain [88604] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88606] (66 PDB entries) |
![]() | Domain d1rk0a1: 1rk0 A:182-274 [111848] Other proteins in same PDB: d1rk0a2, d1rk0b_ complexed with nag |
PDB Entry: 1rk0 (more details), 2.61 Å
SCOP Domain Sequences for d1rk0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rk0a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrw
Timeline for d1rk0a1: