Lineage for d1rk0a1 (1rk0 A:182-274)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2021514Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2021804Species Mouse (Mus musculus) [TaxId:10090] [88606] (104 PDB entries)
    Uniprot P01901 22-299
  8. 2021889Domain d1rk0a1: 1rk0 A:182-274 [111848]
    Other proteins in same PDB: d1rk0a2, d1rk0b_
    complexed with ndg

Details for d1rk0a1

PDB Entry: 1rk0 (more details), 2.61 Å

PDB Description: Mhc Class I H-2Kb Heavy Chain Complexed With beta-2 Microglobulin and Herpes Simplex Virus Glycoprotein B peptide
PDB Compounds: (A:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1rk0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rk0a1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrw

SCOPe Domain Coordinates for d1rk0a1:

Click to download the PDB-style file with coordinates for d1rk0a1.
(The format of our PDB-style files is described here.)

Timeline for d1rk0a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rk0a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1rk0b_