Lineage for d1rjze1 (1rjz E:1-99)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2356942Protein beta2-microglobulin [88600] (7 species)
  7. 2357723Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
    Uniprot P01887
  8. 2357879Domain d1rjze1: 1rjz E:1-99 [111847]
    Other proteins in same PDB: d1rjza1, d1rjza2, d1rjzb2, d1rjzd1, d1rjzd2, d1rjze2
    mutant

Details for d1rjze1

PDB Entry: 1rjz (more details), 2.6 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide
PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d1rjze1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjze1 b.1.1.2 (E:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1rjze1:

Click to download the PDB-style file with coordinates for d1rjze1.
(The format of our PDB-style files is described here.)

Timeline for d1rjze1: