SCOP 1.73: Domain d1rjze_: 1rjz E:

Lineage for d1rjze_ (1rjz E:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein beta2-microglobulin [88600] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (85 PDB entries)

8. Domain d1rjze_: 1rjz E: [111847]
   Other proteins in same PDB: d1rjza1, d1rjza2, d1rjzd1, d1rjzd2
   mutant

Details for d1rjze_

PDB Entry: 1rjz, 2.6 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide

PDB Compounds: (E:) Beta-2-microglobulin

SCOP Domain Sequences for d1rjze_:

Sequence; same for both SEQRES and ATOM records:

>d1rjze_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1rjze_:

• d1rjze_ first appeared in SCOP 1.71
  
• d1rjze_ appears in SCOP 1.75
  
• d1rjze_ appears in the current release, SCOPe 2.08, called d1rjze1