Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (22 species) |
Species Mouse (Mus musculus), H-2KB [TaxId:10090] [54481] (40 PDB entries) |
Domain d1rjzd2: 1rjz D:1-181 [111846] Other proteins in same PDB: d1rjza1, d1rjzb_, d1rjzd1, d1rjze_ mutant |
PDB Entry: 1rjz (more details), 2.6 Å
SCOP Domain Sequences for d1rjzd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjzd2 d.19.1.1 (D:1-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2KB [TaxId: 10090]} gphslryfvtavsrpglgeprfisvgyvdntefvrfdsdaenpryeprarwmeqegpeyw eretqkakgneqsfrvdlrtllgyynqskggshtiqvisgcevgsdgrllrgyqqyaydg cdyialnedlktwtaadmaalitkhkweqageaerlraylegtcvewlrrylkngnatll r
Timeline for d1rjzd2:
View in 3D Domains from other chains: (mouse over for more information) d1rjza1, d1rjza2, d1rjzb_, d1rjze_ |