SCOPe 2.01: Domain d1rjzd1: 1rjz D:182-278

Lineage for d1rjzd1 (1rjz D:182-278)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
   Uniprot P01901 22-299

8. Domain d1rjzd1: 1rjz D:182-278 [111845]
   Other proteins in same PDB: d1rjza2, d1rjzb_, d1rjzd2, d1rjze_
   mutant

Details for d1rjzd1

PDB Entry: 1rjz, 2.6 Å

PDB Description: mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and herpies simplex virus mutant glycoprotein b peptide

PDB Compounds: (D:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1rjzd1:

Sequence; same for both SEQRES and ATOM records:

>d1rjzd1 b.1.1.2 (D:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

Timeline for d1rjzd1:

• d1rjzd1 first appeared in SCOP 1.71
  
• d1rjzd1 appears in SCOP 1.75
  
• d1rjzd1 appears in SCOPe 2.02
  
• d1rjzd1 appears in the current release, SCOPe 2.08