Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (4 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries) Uniprot P01901 22-299 |
Domain d1rjzd1: 1rjz D:182-278 [111845] Other proteins in same PDB: d1rjza2, d1rjzb_, d1rjzd2, d1rjze_ mutant |
PDB Entry: 1rjz (more details), 2.6 Å
SCOP Domain Sequences for d1rjzd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rjzd1 b.1.1.2 (D:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]} tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf qkwasvvvplgkeqyytchvyhqglpepltlrweppp
Timeline for d1rjzd1:
View in 3D Domains from other chains: (mouse over for more information) d1rjza1, d1rjza2, d1rjzb_, d1rjze_ |