Lineage for d1rjzd1 (1rjz D:182-278)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2348364Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2349424Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 2349724Species Mouse (Mus musculus) [TaxId:10090] [88606] (110 PDB entries)
    Uniprot P01901 22-299
  8. 2349815Domain d1rjzd1: 1rjz D:182-278 [111845]
    Other proteins in same PDB: d1rjza2, d1rjzb1, d1rjzb2, d1rjzd2, d1rjze1, d1rjze2
    mutant

Details for d1rjzd1

PDB Entry: 1rjz (more details), 2.6 Å

PDB Description: Mhc Class I Natural Mutant H-2Kbm8 Heavy Chain Complexed With beta-2 Microglobulin and Herpies Simplex Virus Mutant Glycoprotein B Peptide
PDB Compounds: (D:) h-2 class I histocompatibility antigen, k-b alpha chain

SCOPe Domain Sequences for d1rjzd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rjzd1 b.1.1.2 (D:182-278) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhsrpedkvtlrcwalgfypaditltwqlngeeliqdmelvetrpagdgtf
qkwasvvvplgkeqyytchvyhqglpepltlrweppp

SCOPe Domain Coordinates for d1rjzd1:

Click to download the PDB-style file with coordinates for d1rjzd1.
(The format of our PDB-style files is described here.)

Timeline for d1rjzd1: